HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F9GLR6",
"id": "F9GLR6_HAEHA",
"source_organism": {
"taxId": "1028803",
"scientificName": "Haemophilus haemolyticus M19501",
"fullName": "Haemophilus haemolyticus M19501"
},
"name": "Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta",
"description": [
"Component of the acetyl coenzyme A carboxylase (ACC) complex. Biotin carboxylase (BC) catalyzes the carboxylation of biotin on its carrier protein (BCCP) and then the CO(2) group is transferred by the transcarboxylase to acetyl-CoA to form malonyl-CoA"
],
"length": 296,
"sequence": "MSWINRIFSKSPSSSTRKANVPEGVWTKCTSCEQVLYSEELKRNLYVCPKCGHHMRIDARERLLNLLDEGSSQEIAADLEPKDILKFKDLKKYKDRISAAQKETGEKDALITMTGTLYNMPIVVAASNFAFMGGSMGSVVGAKFVKAAEKAMEMNCPFVCFSASGGARMQEALFSLMQMAKTSAVLAQMREKGVPFISVLTDPTLGGVSASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPEGFQRSEFLLEKGAIDMIVKRSEMRQTLASVLSKLTNQPSPFVEPELISEDE",
"proteome": null,
"gene": "accD",
"go_terms": [
{
"identifier": "GO:0003989",
"name": "acetyl-CoA carboxylase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006633",
"name": "fatty acid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0009317",
"name": "acetyl-CoA carboxylase complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ad423d2096b209f54131a5dc6b1d175bbd702505",
"counters": {
"domain_architectures": 12024,
"entries": 14,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"profile": 1,
"pfam": 2,
"hamap": 1,
"ncbifam": 1,
"panther": 1,
"prints": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 12024
}
}
}