General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F9F6J9",
        "id": "F9F6J9_FUSOF",
        "source_organism": {
            "taxId": "660025",
            "scientificName": "Fusarium oxysporum (strain Fo5176)",
            "fullName": "Fusarium oxysporum (strain Fo5176) (Fusarium vascular wilt)"
        },
        "name": "Very-long-chain 3-oxoacyl-CoA reductase",
        "description": [
            "Component of the microsomal membrane bound fatty acid elongation system, which produces the 26-carbon very long-chain fatty acids (VLCFA) from palmitate. Catalyzes the reduction of the 3-ketoacyl-CoA intermediate that is formed in each cycle of fatty acid elongation. VLCFAs serve as precursors for ceramide and sphingolipids"
        ],
        "length": 334,
        "sequence": "MDAITDFLHNVPQPLQWGLAGIGALFLGSKILSYLQLVLSAFVLGGTNLRKYGKPGTWAVITGASDGLGKEYALQLAAKGFNLVLVSRTLSKLESLSAEIQQKYPGKGLQVKVLDMDFSQNNDADYERLSELISGLDVGILINNVGQSHSIPVSFLETTKEELQNIVTINCIGTLRVTQVVAPVLKQRKRGLILTMGSFGGWTPTPLLATYSGSKAFLQQWSNALSAELADHNVDVYLVLSHLVTTAMSKVRRPSLLVPNARNFVKATLGKIGLGGYQTAPNTYTPWWSHAFMLWFIENIPGANGPITIFFNKRMHEDIRRRALRKAARDAKKQ",
        "proteome": null,
        "gene": "FOXB_02024",
        "go_terms": [
            {
                "identifier": "GO:0045703",
                "name": "ketoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0030497",
                "name": "fatty acid elongation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005783",
                "name": "endoplasmic reticulum",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a0c95b509a3fe852564663f48768d986938c9d65",
        "counters": {
            "domain_architectures": 599639,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "hamap": 1,
                "panther": 1,
                "pirsf": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 599639
        }
    }
}