HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F8MJI2",
"id": "F8MJI2_NEUT8",
"source_organism": {
"taxId": "510951",
"scientificName": "Neurospora tetrasperma (strain FGSC 2508 / ATCC MYA-4615 / P0657)",
"fullName": "Neurospora tetrasperma (strain FGSC 2508 / ATCC MYA-4615 / P0657)"
},
"name": "RNA exonuclease 4",
"description": [
"Exoribonuclease involved in ribosome biosynthesis. Involved in the processing of ITS1, the internal transcribed spacer localized between the 18S and 5.8S rRNAs"
],
"length": 409,
"sequence": "MAPELSSNWKKLQEKLKAPQPTKSAPISQEAAFKQAISKKSISSETLKRKAEESQQQQISNPSKKPKRQKSQTQSQPSQKPTEEKMGGNVQSKPTTSSSPNSTLPSLHLWADEQGISSESLAEAYNLGLRSTSSSSSHIPLLSTLPPAIPNAGLTLPGQSSSSSSSSSTSSTPSNKNGLPLPTDLPSSLTLSNGLTLDTSTTTDLALILQATKSNTLGKYLSIDCEMVGTGPSGVTSVLARCSIVDFHGHQIYDSYVRPTAFVTDWRTHVSGISKRHMASARSFESVQATVAALLKGRILVGHDVKHDLEVLGFEHPHRDIRDTAKYSGFRKYGHGPKPSLRVLAKEVLGIEIHQGQHSSVEDARVAMLLFRKEKHGFDMENSNRYEEGQAKKGGNGGGGGGKKKKGKK",
"proteome": "UP000008065",
"gene": "NEUTE1DRAFT_80552",
"go_terms": [
{
"identifier": "GO:0003676",
"name": "nucleic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008408",
"name": "3'-5' exonuclease activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006364",
"name": "rRNA processing",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0004527",
"name": "exonuclease activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5aad122e81bfc5b649ae462596f1030cc5a1692e",
"counters": {
"domain_architectures": 85258,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"smart": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 85258
}
}
}