General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F8L1U4",
        "id": "F8L1U4_PARAV",
        "source_organism": {
            "taxId": "765952",
            "scientificName": "Parachlamydia acanthamoebae (strain UV7)",
            "fullName": "Parachlamydia acanthamoebae (strain UV7)"
        },
        "name": "UDP-3-O-acyl-N-acetylglucosamine deacetylase",
        "description": [
            "Catalyzes the hydrolysis of UDP-3-O-myristoyl-N-acetylglucosamine to form UDP-3-O-myristoylglucosamine and acetate, the committed step in lipid A biosynthesis"
        ],
        "length": 294,
        "sequence": "MNAFNSSLEKTCRRQRTLKKSVSFSGIGIHTGRGVSLKFCPAKEGTGIVFKRVDLPSQPLIPATVEYVCETNRSTTLGIGSVRIHTVEHVLAAIRAYEISNLCIEITSIEPPVGNGSSDVFVEMIEEAGIEEQDGIIPVVKIQEPVYWSEGDIHLVALPADEYRISYTLSYPTPSILQAQFHSLSVTAESFKNELAPCRTFSLYQEVSVLMDKGLIQGASLNNGVTIKDGAVLSKGGLFFPNEMVRHKILDMIGDFSLVGFDFLAHVIAIRSGHASNFAFAKKLLHSITTERCS",
        "proteome": "UP000000495",
        "gene": "lpxC",
        "go_terms": [
            {
                "identifier": "GO:0103117",
                "name": "UDP-3-O-acyl-N-acetylglucosamine deacetylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009245",
                "name": "lipid A biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8045144b91c2acf5e3b3d9f87a32692b4dcb71e0",
        "counters": {
            "domain_architectures": 11871,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 11871
        }
    }
}