HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F7YVY9",
"id": "F7YVY9_9THEM",
"source_organism": {
"taxId": "688269",
"scientificName": "Pseudothermotoga thermarum DSM 5069",
"fullName": "Pseudothermotoga thermarum DSM 5069"
},
"name": "Probable dual-specificity RNA methyltransferase RlmN",
"description": [
"Specifically methylates position 2 of adenine 2503 in 23S rRNA and position 2 of adenine 37 in tRNAs"
],
"length": 343,
"sequence": "MNILGFSYEEFVEEIVKLGLERYRADQVLDWVYQKLVFSFDQMTNLSKEHRRLLPQHFSIDLPKVVEKKVSKFDKTTKYLFELKDGNTIESVLLFHEGYATACISTQVGCPIRCSFCATGQSGFVRNLEVDEIVSQILAIEADSRQKIRNVVYMGMGEPLLNYDNVVKSVRILNHKKMKNIGIRRITISTVGIPEKIIKLGQEGLDINLAISLHASSNEKRMQIIPLASKYAIEEILDAAKQFQQNTDRRVTIEYILIKEFNDYDEDARRLAKILKEMKMKVFVNLIPVNPALPGLERPSIWKINRFKEILVESGIEAEVRREKGVDIEAACGQLRLRALQKR",
"proteome": "UP000006804",
"gene": "rlmN",
"go_terms": [
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051536",
"name": "iron-sulfur cluster binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008173",
"name": "RNA methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006364",
"name": "rRNA processing",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0030488",
"name": "tRNA methylation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0070475",
"name": "rRNA base methylation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c13ed286dda33645f2740866658bbdc34c2d4ac8",
"counters": {
"domain_architectures": 21482,
"entries": 23,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"cathgene3d": 2,
"profile": 1,
"ssf": 1,
"smart": 1,
"cdd": 1,
"pirsf": 1,
"hamap": 1,
"sfld": 3,
"ncbifam": 1,
"panther": 1,
"interpro": 8
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 21482
}
}
}