GET /api/protein/UniProt/F7XYC1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F7XYC1",
        "id": "F7XYC1_TREPP",
        "source_organism": {
            "taxId": "891398",
            "scientificName": "Tremblaya princeps (strain PCIT)",
            "fullName": "Tremblaya princeps (strain PCIT)"
        },
        "name": "Ribosomal RNA small subunit methyltransferase G",
        "description": [
            "Specifically methylates the N7 position of guanine in position 527 of 16S rRNA"
        ],
        "length": 234,
        "sequence": "MKPEDVAEHTRRCACAIGMLLSAHATRAMASLSRSIARWNATHGLTSRGPMRSTVVPHICDAASIGAVVVSLIMPAWPGMPVTVVDMGSGAGHASMALGAMMPCLRVISLEASPDKSVFQSYMQRKLGLCNLRVLRPRDASASAMGAEAIIARALVPYPCKLRRVFKQGWIGAVITASGSYSYVATAVAARVGGCRSVCAARLKVPMVSKRRYVVITGAACLAVPQPAMQAGAL",
        "proteome": null,
        "gene": "rsmG",
        "go_terms": [
            {
                "identifier": "GO:0008649",
                "name": "rRNA methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006364",
                "name": "rRNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "dab470c3cc0611b3efe4c44bfc5a79eb65c34c07",
        "counters": {
            "domain_architectures": 25728,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "hamap": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 25728
        }
    }
}