General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F7HHW6",
        "id": "F7HHW6_CALJA",
        "source_organism": {
            "taxId": "9483",
            "scientificName": "Callithrix jacchus",
            "fullName": "Callithrix jacchus (White-tufted-ear marmoset)"
        },
        "name": "Elongation of very long chain fatty acids protein 4",
        "description": [
            "Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Condensing enzyme that specifically elongates C24:0 and C26:0 acyl-CoAs. May participate to the production of saturated and monounsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators. May play a critical role in early brain and skin development"
        ],
        "length": 314,
        "sequence": "MGLLDSEPGSVLNVVSTALNDTVEFYRWTWSIADKRVENWPLMQSPWPTLSISTLYLLFVWLGPKWMKDREPFQMRLVLIFYNFGMVLLNLFIFRELFMGSYNAGYSYICQSVDYSDNVNEVRIAAALWWYFVSKGVEYLDTVFFILRKKNNQVSFLHVYHHCTMFTLWWIGIKWVAGGQAFFGAQMNSFIHVIMYSYYGLTAFGPWIQKYLWWKRYLTMLQLVQFHVTIGHTALSLYTDCPFPKWMHWALIAYAISFIFLFLNFYVRTYKEPRKSKTGKTAMNGISANGVSKSEKQLAIENGKNQKNGKAKGE",
        "proteome": "UP000008225",
        "gene": "ELOVL4",
        "go_terms": [
            {
                "identifier": "GO:0009922",
                "name": "fatty acid elongase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019367",
                "name": "fatty acid elongation, saturated fatty acid",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0042761",
                "name": "very long-chain fatty acid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005783",
                "name": "endoplasmic reticulum",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "726b44df556ad17af08cf1eeb76a7efce6e198bf",
        "counters": {
            "domain_architectures": 25966,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "hamap": 1,
                "panther": 1,
                "pfam": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 25966
        }
    }
}