GET /api/protein/UniProt/F7GJ67/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F7GJ67",
"id": "F7GJ67_MONDO",
"source_organism": {
"taxId": "13616",
"scientificName": "Monodelphis domestica",
"fullName": "Monodelphis domestica (Gray short-tailed opossum)"
},
"name": "Trafficking protein particle complex subunit",
"description": [
"Core component of the TRAPP complexes which has a function of guanine nucleotide exchange factor activity for Rab1 GTPase. Plays a role in vesicular transport from endoplasmic reticulum to Golgi and autophagy. May play a role in dendrite postsynaptic membrane trafficking"
],
"length": 219,
"sequence": "MAIFSVYVVNKAGGLIYQLDNYAPRAEGEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVGHAVLSINGVDVNGKYTAEGKEVLEYLGNPANYPVSIRFGRPRLTSNEKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLHCFQTLTGIKFVVLADPRQGGIDSLLRKIYEIYSDFALKNPFYSLEMPIRCELFDQNLKLALEVAEKAGTFGPGS",
"proteome": "UP000002280",
"gene": "TRAPPC4",
"go_terms": [
{
"identifier": "GO:0016192",
"name": "vesicle-mediated transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0030008",
"name": "TRAPP complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "01c70fce1f059b606197d5d1a38b4caee0ef25e0",
"counters": {
"domain_architectures": 7999,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"smart": 1,
"cdd": 1,
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 7999
}
}
}