GET /api/protein/UniProt/F7FV40/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F7FV40",
        "id": "F7FV40_MACMU",
        "source_organism": {
            "taxId": "9544",
            "scientificName": "Macaca mulatta",
            "fullName": "Macaca mulatta (Rhesus macaque)"
        },
        "name": "Ran guanine nucleotide release factor",
        "description": [
            "May regulate the intracellular trafficking of RAN. Promotes guanine nucleotide release from RAN and inhibits binding of new GTP by preventing the binding of the RAN guanine nucleotide exchange factor RCC1. Regulates the levels of GTP-bound RAN in the nucleus, and thereby plays a role in the regulation of RAN-dependent mitotic spindle dynamics. Enhances the expression of SCN5A at the cell membrane in cardiomyocytes"
        ],
        "length": 186,
        "sequence": "MEPMRDCPLFGGAFSAILPTGAIDVSDLRPVPDNQEVFCHPVTDQSLIVELLELQAHVHGEAAARYHFEDVGGVQGARAVHVESVQPLSLENLALRGCCQEAWVLSGKQQIAKENQQVAKDVTLHQALLRLPQYQTDLLLTFNQPPPDNRSSLGPENLSPPHWSLGDFEQLVTSLTLHDPNIFGPQ",
        "proteome": "UP000006718",
        "gene": "RANGRF",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0283c1bcbc7e58d3a48f65131ec33b809fa9a068",
        "counters": {
            "domain_architectures": 3390,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3390
        }
    }
}