GET /api/protein/UniProt/F7FFV2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F7FFV2",
        "id": "F7FFV2_RAT",
        "source_organism": {
            "taxId": "10116",
            "scientificName": "Rattus norvegicus",
            "fullName": "Rattus norvegicus (Rat)"
        },
        "name": "Keratin, type II cytoskeletal 5",
        "description": [
            "Required for the formation of keratin intermediate filaments in the basal epidermis and maintenance of the skin barrier in response to mechanical stress. Regulates the recruitment of Langerhans cells to the epidermis, potentially by modulation of the abundance of macrophage chemotactic cytokines, macrophage inflammatory cytokines and CTNND1 localization in keratinocytes"
        ],
        "length": 395,
        "sequence": "VRFLEQQNKVLDTKWTLLQEQGTKTIKQNLDPLFEQYINNLRRQLDGVMGERGRLDSELRNMQDLVEDYKNKYEDEINKRTTAENEFVMLKKDVDAAYMNKVELEAKVDALMDEINFMKMFFDAELSQMQTHVSDTSVVLSMDNNRSLDLDSIIAEVKAQYEDIANRSRTEAESWYQTKYEELQQTAGRHGDDLRNTKHEISEMNRMIQRLRSEIDNVKKQCANLQNAIAEAEQRGELALKDARNKLTELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEGEECRLSGEGVGPVNISVVTNSLSSGYGGRSNIGYGSGLGSGIGGFASDIGPLLNRRGLGSGLSVGGSGFSASSGQGGGFSSGGGSSSSVKFVSTTSSSRRSFKS",
        "proteome": "UP000002494",
        "gene": "Krt5",
        "go_terms": [
            {
                "identifier": "GO:0045095",
                "name": "keratin filament",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3f9fb03eda00cfd8b97af52f74c752bf468784aa",
        "counters": {
            "domain_architectures": 32698,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "profile": 1,
                "cathgene3d": 3,
                "ssf": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 32698
        }
    }
}