General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F7ECV7",
        "id": "F7ECV7_MONDO",
        "source_organism": {
            "taxId": "13616",
            "scientificName": "Monodelphis domestica",
            "fullName": "Monodelphis domestica (Gray short-tailed opossum)"
        },
        "name": "Lactoylglutathione lyase",
        "description": [
            "Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione. Involved in the regulation of TNF-induced transcriptional activity of NF-kappa-B. Required for normal osteoclastogenesis"
        ],
        "length": 184,
        "sequence": "MAESSQALEGLTDEAAESFCSDPDPSTKDFLLQQTMLRIKDPKKSLDFYTRVLGMTLLQKCDFPTMKFSLYFLAFEDKNDIPKDKGERTAWTFSRKATLELTHNWGTENDENQAYHNGNSDPRGFGHIGIAVPDVQGACKRFEELGVKFVKKPDEGKMKGLAFIQDPDGYWIEILNPNHMKILT",
        "proteome": "UP000002280",
        "gene": "GLO1",
        "go_terms": [
            {
                "identifier": "GO:0004462",
                "name": "lactoylglutathione lyase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f6fc47aaf49959195ed3151be38adf7fe3bbd281",
        "counters": {
            "domain_architectures": 232632,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 1,
                "prosite": 2,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 232632
        }
    }
}