General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F7E8V5",
        "id": "F7E8V5_MACMU",
        "source_organism": {
            "taxId": "9544",
            "scientificName": "Macaca mulatta",
            "fullName": "Macaca mulatta (Rhesus macaque)"
        },
        "name": "Bcl-2-related protein A1",
        "description": [
            "Retards apoptosis induced by IL-3 deprivation. May function in the response of hemopoietic cells to external signals and in maintaining endothelial survival during infection. Can inhibit apoptosis induced by serum starvation in the mammary epithelial cell line HC11"
        ],
        "length": 175,
        "sequence": "MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC",
        "proteome": "UP000006718",
        "gene": "BCL2A1",
        "go_terms": [
            {
                "identifier": "GO:0042981",
                "name": "regulation of apoptotic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0043066",
                "name": "negative regulation of apoptotic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "92ba116244fc0fb74889d66f6dfb45f495b68e25",
        "counters": {
            "domain_architectures": 8374,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "smart": 1,
                "profile": 1,
                "panther": 1,
                "pfam": 1,
                "prosite": 2,
                "prints": 2,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 8374
        }
    }
}