GET /api/protein/UniProt/F7BWR3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F7BWR3",
"id": "F7BWR3_XENTR",
"source_organism": {
"taxId": "8364",
"scientificName": "Xenopus tropicalis",
"fullName": "Xenopus tropicalis (Western clawed frog)"
},
"name": "Glycolipid transfer protein domain-containing protein",
"description": [
"Accelerates the intermembrane transfer of various glycolipids. Catalyzes the transfer of various glycosphingolipids between membranes but does not catalyze the transfer of phospholipids. May be involved in the intracellular translocation of glucosylceramides"
],
"length": 209,
"sequence": "MSVLLQHQFKPLPADKQIDTCCFLDSVSHLPAFFDCLGSAIFSPIKADITGNISKIRSVYESNPSKFKTLQMILEGEKELHGPQWPKVGATLALMWLKRGLKFIQVMLQSIADGERDDQNPNLIKVNITKAYEIALKKYHGWFVQKIFQTALIAAPYKDDFLKALSKGQTVKEEECIEKIRQFLVNYTTTIEAIYIMYNKMNAELDYKA",
"proteome": "UP000008143",
"gene": "gltp",
"go_terms": [
{
"identifier": "GO:0120013",
"name": "lipid transfer activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0120009",
"name": "intermembrane lipid transfer",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "100d0faecafb2f43a184bcc4d2aeb76d1a3f74b4",
"counters": {
"domain_architectures": 10213,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 10213
}
}
}