GET /api/protein/UniProt/F7BIG3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F7BIG3",
"id": "F7BIG3_CALJA",
"source_organism": {
"taxId": "9483",
"scientificName": "Callithrix jacchus",
"fullName": "Callithrix jacchus (White-tufted-ear marmoset)"
},
"name": "Ileal sodium/bile acid cotransporter",
"description": [
"Plays a critical role in the sodium-dependent reabsorption of bile acids from the lumen of the small intestine. Transports various bile acids, unconjugated or conjugated, such as cholate and taurocholate. Also responsible for bile acid transport in the renal proximal tubules, a salvage mechanism that helps conserve bile acids. Works collaboratively with the Na(+)-taurocholate cotransporting polypeptide (NTCP), the organic solute transporter (OST), and the bile salt export pump (BSEP), to ensure efficacious biological recycling of bile acids during enterohepatic circulation"
],
"length": 327,
"sequence": "MSGRNICVDNATVCSGASCVVPESNFNNILSVVLSTVLTILLALVMFSMGCNVEIKNFLGHMKRPWGICVGFLCQFGIMPLVGFILSVAFDILPIQAVVVLIMGCCPGGTASNILAYWVDGDMDLSISMTTCSTLLALGMMPLCLLIYTKMWVDSGSLKIPYDNIGTSLVALVVPVSIGMFVNHKWPQKAKIILKIGSIAGAVLIVLIAVVGGILYQGAWIIQPNLWIIGTIFPVAGYTLGFLLARIAGQPWHRCRTVAFETGMQNTQLCSTIVQLSFTPEELNVIFTFPLIYSIFQLAVAAIFVGFYVAYKKCHGKNKAELPEQRK",
"proteome": "UP000008225",
"gene": "SLC10A2",
"go_terms": [
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6d294eaff84032fb71bba95e40bd3bb1c8391fab",
"counters": {
"domain_architectures": 40851,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ncbifam": 1,
"panther": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 40851
}
}
}