GET /api/protein/UniProt/F7B594/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F7B594",
"id": "F7B594_MONDO",
"source_organism": {
"taxId": "13616",
"scientificName": "Monodelphis domestica",
"fullName": "Monodelphis domestica (Gray short-tailed opossum)"
},
"name": "Nuclear transcription factor Y subunit gamma",
"description": [
"Component of the sequence-specific heterotrimeric transcription factor (NF-Y) which specifically recognizes a 5'-CCAAT-3' box motif found in the promoters of its target genes. NF-Y can function as both an activator and a repressor, depending on its interacting cofactors"
],
"length": 335,
"sequence": "MSTDGGFGSTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYYFTLAQQPAAVQVQGQQTGQQTTTSTTTIQSGQIIIAQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQTQQAPSSTGQTMQVMQQIITNTGEIQQIPVQLNAGQLQYIRLAQPVSGTQVVQGQIQTLAASAQQITQTEVQQGQQQFSQFTDGQQLYQIQQVTMPAGQDLAQPMFIQSANQASDGQTPQVTGD",
"proteome": "UP000002280",
"gene": "NFYC",
"go_terms": [
{
"identifier": "GO:0046982",
"name": "protein heterodimerization activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e204a9d55ad7bafe2e507ca80f663a0ac2378352",
"counters": {
"domain_architectures": 87265,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 87265
}
}
}