GET /api/protein/UniProt/F7ADM1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F7ADM1",
        "id": "F7ADM1_ORNAN",
        "source_organism": {
            "taxId": "9258",
            "scientificName": "Ornithorhynchus anatinus",
            "fullName": "Ornithorhynchus anatinus (Duckbill platypus)"
        },
        "name": "Essential MCU regulator, mitochondrial",
        "description": [
            "Essential regulatory subunit of the mitochondrial calcium uniporter complex (uniplex), a complex that mediates calcium uptake into mitochondria"
        ],
        "length": 106,
        "sequence": "MAAGAAGWLLAVTARSGALRRGVRLGSGGGAAARSGSAAARVPSRTVIATRSGAILPKPAKMSFGLLRVFSIVIPFLYVGTLISKNFAALLEEHDIFVPEDDDDDD",
        "proteome": "UP000002279",
        "gene": "SMDT1",
        "go_terms": [
            {
                "identifier": "GO:0036444",
                "name": "calcium import into the mitochondrion",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0051560",
                "name": "mitochondrial calcium ion homeostasis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:1990246",
                "name": "uniplex complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "df05179c7f30767e4cfd98dada4d48eaed7ae415",
        "counters": {
            "domain_architectures": 1265,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1265
        }
    }
}