GET /api/protein/UniProt/F6ZUY9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F6ZUY9",
"id": "F6ZUY9_XENTR",
"source_organism": {
"taxId": "8364",
"scientificName": "Xenopus tropicalis",
"fullName": "Xenopus tropicalis (Western clawed frog)"
},
"name": "Carbonic anhydrase",
"description": [
"Catalyzes the reversible hydration of carbon dioxide. Can hydrate cyanamide to urea",
"Reversible hydration of carbon dioxide"
],
"length": 262,
"sequence": "MSSLNWGYDSHNGPDQWHKLYPIANGDSQSPIDVKSGEAKADESLKSLSIRYNSDSIKSLVNVGHSFQVLAEDKENPSVVAQGPLKATYRLNQFHFHWGASNDFGSEHTVDGKGYAAELHLVHWNSDKYSSFAEASKNPDGCAVVTVFIKVGSSHPGLQRVVEALELIAAKGKQAAFTNFDASTLLPASMDYWTYQGSLTHPPLLECVTWIIFKEPISASSEQINLFRRILSSAEGEEACPVLANHRPTQPLKGREVRASFQ",
"proteome": "UP000008143",
"gene": "ca1",
"go_terms": [
{
"identifier": "GO:0004089",
"name": "carbonate dehydratase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008270",
"name": "zinc ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7389f00a0050e5feedb519affc5ab13357906adf",
"counters": {
"domain_architectures": 34482,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"ssf": 1,
"smart": 1,
"pfam": 1,
"panther": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 34482
}
}
}