General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F6YVE6",
        "id": "F6YVE6_MONDO",
        "source_organism": {
            "taxId": "13616",
            "scientificName": "Monodelphis domestica",
            "fullName": "Monodelphis domestica (Gray short-tailed opossum)"
        },
        "name": "Motile sperm domain-containing protein 1",
        "description": [
            "Plays a role in differentiation and/or proliferation of mesenchymal stem cells. Proposed to be involved in epithelial-to-mesenchymal transition (EMT). However, another study suggests that it is not required for EMT or stem cell self-renewal and acts during later stages of differentiation"
        ],
        "length": 164,
        "sequence": "MQQPPRQPELGEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPIKYVVVDAAGAVKPQCCVDIVIRHRDVRPCHYDVIDKFRLQVSEQSQGKPLGRKEIIATLLPSAKEQRKEEEEKRLKEHLAESVFFEQMLPGMSTTRVRPSLFNQNL",
        "proteome": "UP000002280",
        "gene": null,
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "15912120c884367a05ea3e431a6fdf0c2c4e326a",
        "counters": {
            "domain_architectures": 18780,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "profile": 1,
                "pfam": 1,
                "cathgene3d": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 18780
        }
    }
}