HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F6XTZ7",
"id": "F6XTZ7_MONDO",
"source_organism": {
"taxId": "13616",
"scientificName": "Monodelphis domestica",
"fullName": "Monodelphis domestica (Gray short-tailed opossum)"
},
"name": "High mobility group nucleosome-binding domain-containing protein 3",
"description": [
"Binds to nucleosomes, regulating chromatin structure and consequently, chromatin-dependent processes such as transcription, DNA replication and DNA repair. Affects both insulin and glucagon levels and modulates the expression of pancreatic genes involved in insulin secretion. Regulates the expression of the glucose transporter SLC2A2 by binding specifically to its promoter region and recruiting PDX1 and additional transcription factors. Regulates the expression of SLC6A9, a glycine transporter which regulates the glycine concentration in synaptic junctions in the central nervous system, by binding to its transcription start site. May play a role in ocular development and astrocyte function"
],
"length": 124,
"sequence": "MPKRKSPEGAEGKDAAKVTKQEPTRRSARLSAKPAPPKPEPKPRKTTKKEPGAKATKGAKGKKDEKQESGKEGTTTPSENGESKAEEIRIYRSTVSVSTSRGAPPSTLSVKGQIETVKVKGTEN",
"proteome": "UP000002280",
"gene": "HMGN3",
"go_terms": [
{
"identifier": "GO:0031492",
"name": "nucleosomal DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000785",
"name": "chromatin",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0005634",
"name": "nucleus",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1eb55ce16369c00ec3ab43dd2b8342203ecc4f39",
"counters": {
"domain_architectures": 4904,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"panther": 1,
"pfam": 1,
"prints": 1,
"prosite": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4904
}
}
}