General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F6WGE7",
        "id": "F6WGE7_CALJA",
        "source_organism": {
            "taxId": "9483",
            "scientificName": "Callithrix jacchus",
            "fullName": "Callithrix jacchus (White-tufted-ear marmoset)"
        },
        "name": "DNA-directed RNA polymerase subunit",
        "description": [
            "Component of RNA polymerase I (Pol I), a DNA-dependent RNA polymerase which synthesizes ribosomal RNA precursors using the four ribonucleoside triphosphates as substrates. Through its association with RRN3/TIF-IA may be involved in recruitment of Pol I to rDNA promoters",
            "DNA-dependent RNA polymerase which catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates"
        ],
        "length": 342,
        "sequence": "MAAGCSEAPRQKAASDGSLVGQAGVLPCLELPTYATACELVNNRYSCLVAGPHRRHIALSPRYLNRKRTGIREQLDAELLRYSESLLGVPIAYDNIKVVGELGDIYDDQGHIHLNIEADFVIFSPEPGQKLMGIVNKVSSSHIGCLVHGCFNASIPKPEQLSAEQWQTMEINMGDELEFEVFRLDSDTAGVFCIRGKLNITSLQFKHSEVSEEVTENGTEEAAEKPIKKKKKKKKDPETYEVDSGTTKLADFADDTPVEESALQNTNNVNDLREEEPKKKKKKKKKKHQEDPNQDPSFQGSDSSGYQSDHKKKKKKRKHSEEAEFTPPLKCSPKKKRKSNFL",
        "proteome": "UP000008225",
        "gene": "POLR1F",
        "go_terms": [
            {
                "identifier": "GO:0006351",
                "name": "DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006352",
                "name": "DNA-templated transcription initiation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "cbda45cd687a25ed0ae40f4ba9862a7caeb4a8bc",
        "counters": {
            "domain_architectures": 960,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "cdd": 1,
                "pfam": 2,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 960
        }
    }
}