General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F6U749",
        "id": "F6U749_MACMU",
        "source_organism": {
            "taxId": "9544",
            "scientificName": "Macaca mulatta",
            "fullName": "Macaca mulatta (Rhesus macaque)"
        },
        "name": "Trafficking protein particle complex subunit 6A",
        "description": [
            "May play a role in vesicular transport during the biogenesis of melanosomes"
        ],
        "length": 173,
        "sequence": "MADTVLFEFLHTEMVAELWAHDPDPGSGVSAGSRGEEVGATTGQKMSLSVLESMGFRVGQALGERLPRETLAFREELDVLKFLCKDLWVAVFQKQMDSLRTNHQGTYVLQDNSFPLLLPMASGLQYLEEAPKFLAFTCGLLRGALCTLGIESVVTASVAALPVCKFQVLIPKS",
        "proteome": "UP000006718",
        "gene": "NKPD1",
        "go_terms": [
            {
                "identifier": "GO:0043087",
                "name": "regulation of GTPase activity",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0048193",
                "name": "Golgi vesicle transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fd3749aa4f0585b0db0c458d1e595e8772804a96",
        "counters": {
            "domain_architectures": 14140,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 14140
        }
    }
}