GET /api/protein/UniProt/F6T798/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F6T798",
"id": "F6T798_CALJA",
"source_organism": {
"taxId": "9483",
"scientificName": "Callithrix jacchus",
"fullName": "Callithrix jacchus (White-tufted-ear marmoset)"
},
"name": "Neurotensin/neuromedin N",
"description": [
"Neurotensin may play an endocrine or paracrine role in the regulation of fat metabolism. It causes contraction of smooth muscle"
],
"length": 170,
"sequence": "MMAGMKIQLVCILLLAFSSLSLCSDSEEEMKALEADLMTNMHTSKISKTSVPSWKMTLLNVCSLVNNLNSPAEETGEVREEELVTRRKFPAALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILETGNDKMEKEEVIKRKIPYILKRQLYENKPRRPYILKRDSYYY",
"proteome": "UP000008225",
"gene": "NTS",
"go_terms": [
{
"identifier": "GO:0005184",
"name": "neuropeptide hormone activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005576",
"name": "extracellular region",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a44aa20e667f89091e487d01cbd8674616cd74bd",
"counters": {
"domain_architectures": 854,
"entries": 4,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"pfam": 1,
"prints": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 854
}
}
}