General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F6T798",
        "id": "F6T798_CALJA",
        "source_organism": {
            "taxId": "9483",
            "scientificName": "Callithrix jacchus",
            "fullName": "Callithrix jacchus (White-tufted-ear marmoset)"
        },
        "name": "Neurotensin/neuromedin N",
        "description": [
            "Neurotensin may play an endocrine or paracrine role in the regulation of fat metabolism. It causes contraction of smooth muscle"
        ],
        "length": 170,
        "sequence": "MMAGMKIQLVCILLLAFSSLSLCSDSEEEMKALEADLMTNMHTSKISKTSVPSWKMTLLNVCSLVNNLNSPAEETGEVREEELVTRRKFPAALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILETGNDKMEKEEVIKRKIPYILKRQLYENKPRRPYILKRDSYYY",
        "proteome": "UP000008225",
        "gene": "NTS",
        "go_terms": [
            {
                "identifier": "GO:0005184",
                "name": "neuropeptide hormone activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a44aa20e667f89091e487d01cbd8674616cd74bd",
        "counters": {
            "domain_architectures": 854,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "prints": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 854
        }
    }
}