General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F6QFW9",
        "id": "F6QFW9_MACMU",
        "source_organism": {
            "taxId": "9544",
            "scientificName": "Macaca mulatta",
            "fullName": "Macaca mulatta (Rhesus macaque)"
        },
        "name": "Catechol O-methyltransferase",
        "description": [
            "Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol"
        ],
        "length": 270,
        "sequence": "MLEAPPLLLAAVFLGLVLVVLLLILRRWGWGLCLICWNEFVLQPIRNLLMGDTKEQRILHHVLQHAEPGNAQSVVEAIDTYCQQKEWAMNVGDKKGKIVDAVIQEHQPSMLLELGAYCGYSAVRMARLLSPGARLLTIEINPDYAAITQRMVDFAGMQDKVTVVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRRSNRFECTHYQSFLEYRKVVDGLEKAIYKGPGSEAQP",
        "proteome": null,
        "gene": "COMT",
        "go_terms": [
            {
                "identifier": "GO:0008171",
                "name": "O-methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000287",
                "name": "magnesium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016206",
                "name": "catechol O-methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006584",
                "name": "catecholamine metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "61fab28cf5cb7ba8c3e444a0492b7c32b33d56bb",
        "counters": {
            "domain_architectures": 33538,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 33538
        }
    }
}