General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F6PV05",
        "id": "F6PV05_HORSE",
        "source_organism": {
            "taxId": "9796",
            "scientificName": "Equus caballus",
            "fullName": "Equus caballus (Horse)"
        },
        "name": "CWH43-like N-terminal domain-containing protein",
        "description": [
            "Modulator of macroautophagy that causes accumulation of autophagosomes under basal conditions and enhances autophagic flux. Represses cell death and promotes long-term clonogenic survival of cells grown in the absence of glucose in a macroautophagy-independent manner. May have some role in extracellular matrix engulfment or growth factor receptor recycling, both of which can modulate cell survival"
        ],
        "length": 282,
        "sequence": "TSLKASPISVSVDLTRLRAASSARCSTWELLWVNTPQHFPLSVSPSQPRGPQLPSDPGVETPSSHLPQTREFGRHPWTASLSPPHHPRHHPPPTQGAGPGSPAHFPLLPAAWICILRYHQLRDLGVGKRLNRLILCSGILCALGTSVVGNFQQKNQQPTHLTGAFFAFFVGSLYFWLQLLVSWRMRTLPQPGAPWIRPLRLGLCSVCTILMVAMVVLHSWPLRSASAACEWAVAMLLFALFGLLAVDFSGLEGCTLCLQPGPSLSPPPASPMSLQVQLSQAL",
        "proteome": "UP000002281",
        "gene": "TMEM150B",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ab18c14a05b6d083e3b0fef65d3721398aa0f31f",
        "counters": {
            "domain_architectures": 12942,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 12942
        }
    }
}