HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F6I5I6",
"id": "F6I5I6_VITVI",
"source_organism": {
"taxId": "29760",
"scientificName": "Vitis vinifera",
"fullName": "Vitis vinifera (Grape)"
},
"name": "Geranylgeranyl transferase type-2 subunit beta",
"description": [
"Catalyzes the transfer of a geranylgeranyl moiety from geranylgeranyl diphosphate to both cysteines of proteins with the C-terminal sequence -XXCC, -XCXC and -CCXX",
"Required for male fertility and root tip growth"
],
"length": 345,
"sequence": "MSKMNIMWVLLSLASNLEWPLRNKIKFTMEGQIGDLEVEKHVQYILSVEKRKDNFESVVMEHLRMNGAYWGLTTLDLLGKLDMVDEDEIISWVMECQHESGGFGGNVGHDPHILYTLSAVQVLALFDKLNVLDIDKVSNYIAGLQNEDGSFSGDMWGEIDTRFSYIAICSLSLLQRLDKINVEKAVNYIVSCKNLDGGFGCTPGAESHAGQIFCCVSALALTGSLHHVDKDLLGWWLCERQVKSGALNGRPEKLPDVCYSWWVLSSLIMIDRAHWIDKEKLIKFILDCQDKENGGISDRPDDAVDVFHTYFGVAGLAHLEYPGLKAVDPAYALPVDVVNRIFFSR",
"proteome": "UP000009183",
"gene": "VIT_15s0024g00080",
"go_terms": [
{
"identifier": "GO:0004663",
"name": "Rab geranylgeranyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0018344",
"name": "protein geranylgeranylation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008318",
"name": "protein prenyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "27821e6700fa05503d29e155fba8182fc24a5d15",
"counters": {
"domain_architectures": 14013,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 14013
}
}
}