HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F6BE33",
"id": "F6BE33_METIK",
"source_organism": {
"taxId": "880724",
"scientificName": "Methanotorris igneus (strain DSM 5666 / JCM 11834 / Kol 5)",
"fullName": "Methanotorris igneus (strain DSM 5666 / JCM 11834 / Kol 5)"
},
"name": "Tritrans,polycis-undecaprenyl-diphosphate synthase (geranylgeranyl-diphosphate specific)",
"description": [
"Catalyzes the sequential condensation of isopentenyl diphosphate (IPP) with geranylgeranyl diphosphate (GGPP) to yield (2Z,6Z,10Z,14Z,18Z,22Z,26Z,30E,34E,38E)-undecaprenyl diphosphate (tritrans,heptacis-UPP). It is probably the precursor of glycosyl carrier lipids"
],
"length": 265,
"sequence": "MFLLIKLYNLLSKMGILKIYEKILEKEIDRSRVPKHVGIIMDGNRRTAKELKKPVTYGHYLGAEKVREVLKWCIDLDIKIVTVYAFSMENFRRPKEEVKALMELFKKKFIEVAKDEDIHKYKVRVRAIGRINKLPKDVQDAIKYAEEKTKNYSNYFLNIAIAYGGQQEIVDAVKKIAKKIKNNELDIEDITEETISKHLYTANLPYPNPDLIIRTSGEERISNFLTWQSSYSELYFCETYWPLFRKIDFLRAIRDYQRRERRFGR",
"proteome": "UP000009227",
"gene": "uppS",
"go_terms": [
{
"identifier": "GO:0016765",
"name": "transferase activity, transferring alkyl or aryl (other than methyl) groups",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f9296ca8c67aab66dba96afb706e180e443bedbe",
"counters": {
"domain_architectures": 40247,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"panther": 1,
"ncbifam": 1,
"hamap": 1,
"pfam": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 40247
}
}
}