GET /api/protein/UniProt/F6BA69/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F6BA69",
"id": "F6BA69_METIK",
"source_organism": {
"taxId": "880724",
"scientificName": "Methanotorris igneus (strain DSM 5666 / JCM 11834 / Kol 5)",
"fullName": "Methanotorris igneus (strain DSM 5666 / JCM 11834 / Kol 5)"
},
"name": "Isopentenyl phosphate kinase",
"description": [
"Catalyzes the formation of isopentenyl diphosphate (IPP), the building block of all isoprenoids"
],
"length": 257,
"sequence": "MLIILKLGGSILSDKNTPFSVKWDNLERFGEEIRNAMEYYKEKNEKLNLIIVHGGGSFGHPVAKKYLRDGKFCNMQKGFWEIQKAMRRFNNLVIDTLHFYDIPAVSIQPSSFVVFKKDSLIFDLSAIKELLKRDLVPVVHGDIVVDDDDNYKILSGDHILPYLTKKLNVDLSLHASDVDGVLDENGNVIEKIDKSNIDDVLKMLKDSKGIDVTGGMYLKVMEAYKMGVKTIIFNGNKRGNIYNALIGNVMGTVIIGD",
"proteome": "UP000009227",
"gene": "Metig_0202",
"go_terms": [
{
"identifier": "GO:0016301",
"name": "kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b73790bda6cd15191430dc28c4ec048bb434309a",
"counters": {
"domain_architectures": 77738,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"pirsf": 1,
"panther": 1,
"ncbifam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 77738
}
}
}