HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F5RQ38",
"id": "F5RQ38_9FIRM",
"source_organism": {
"taxId": "888060",
"scientificName": "Centipeda periodontii DSM 2778",
"fullName": "Centipeda periodontii DSM 2778"
},
"name": "Coenzyme A biosynthesis bifunctional protein CoaBC",
"description": [
"Catalyzes two sequential steps in the biosynthesis of coenzyme A. In the first step cysteine is conjugated to 4'-phosphopantothenate to form 4-phosphopantothenoylcysteine. In the second step the latter compound is decarboxylated to form 4'-phosphopantotheine",
"Catalyzes two steps in the biosynthesis of coenzyme A. In the first step cysteine is conjugated to 4'-phosphopantothenate to form 4-phosphopantothenoylcysteine, in the latter compound is decarboxylated to form 4'-phosphopantotheine"
],
"length": 406,
"sequence": "MRASDMGALAGRRIVLGVTGGIAAYKAVEIARRLKKAGADVRVVMTRAAASFVTPLTFREITGRPVAETMWGEPHHHVEHIALAEFAELVLVAPATANFIAKAAAGIADDMLTTSVLATRASLLIAPAMNTGMWENPVTQENVARLTARGVTVIPPAAGQLACGTTGAGRLPEPVEIVRVVEEYFSRTQSLVGRRILVTAAGTEEALDPVRYLGNRSTGRMGFAVAAEAVRRGAEVILVAGPTPLTTPAGVRRVDVRSARDMHAAVLAEYDAVDAVIKAAAVADYRPAEIAAHKIKKSDGELTITLTRNPDILYELGQKKQHQILVGFAAETQNVAEYARGKLAKKNLDFIVANNVAEKDAGFGVPTNHVQIFYADGRAEDHPLMAKSELAGVILDRLEETFQKRG",
"proteome": "UP000004067",
"gene": "coaBC",
"go_terms": [
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004632",
"name": "phosphopantothenate--cysteine ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004633",
"name": "phosphopantothenoylcysteine decarboxylase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0010181",
"name": "FMN binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0015937",
"name": "coenzyme A biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0015941",
"name": "pantothenate catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ae56f16f585a747ec4bcf527a1a938b2bbf62363",
"counters": {
"domain_architectures": 23529,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"pfam": 2,
"ncbifam": 1,
"panther": 1,
"hamap": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 23529
}
}
}