GET /api/protein/UniProt/F5P3H1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F5P3H1",
        "id": "F5P3H1_SHIFL",
        "source_organism": {
            "taxId": "766147",
            "scientificName": "Shigella flexneri K-227",
            "fullName": "Shigella flexneri K-227"
        },
        "name": "3-keto-L-gulonate-6-phosphate decarboxylase UlaD",
        "description": [
            "Catalyzes the decarboxylation of 3-keto-L-gulonate-6-P into L-xylulose-5-P. Is involved in the anaerobic L-ascorbate utilization"
        ],
        "length": 216,
        "sequence": "MSLPMLQVALDNQTMDSAYETTRLIAEEVDIIEVGTILCVGEGVRAVRDLKALYPHKIVLADAKIADAGKILSRMCFEANADWVTVICCADINTAKGALDVAKEFNGDVQIELTGYWTWEQAQQWRDAGIQQVVYHRSRDAQAAGVAWGEADITAIKRLSDMGFKVTVTGGLALEDLPLFKGIPIHVFIAGRSIRDAASPVEAARQFKRSIAELWG",
        "proteome": null,
        "gene": "ulaD",
        "go_terms": [
            {
                "identifier": "GO:0004590",
                "name": "orotidine-5'-phosphate decarboxylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006207",
                "name": "'de novo' pyrimidine nucleobase biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0000287",
                "name": "magnesium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0033982",
                "name": "3-dehydro-L-gulonate-6-phosphate decarboxylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019854",
                "name": "L-ascorbic acid catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "bfa259cb295edeb275c86a7b575c2fbeb1ad6dbe",
        "counters": {
            "domain_architectures": 35089,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "smart": 1,
                "cathgene3d": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 35089
        }
    }
}