General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F5A531",
        "id": "F5A531_MARMO",
        "source_organism": {
            "taxId": "9995",
            "scientificName": "Marmota monax",
            "fullName": "Marmota monax (Woodchuck)"
        },
        "name": "Programmed cell death 1 ligand 1",
        "description": [
            "The PDCD1-mediated inhibitory pathway is exploited by tumors to attenuate anti-tumor immunity and escape destruction by the immune system, thereby facilitating tumor survival. The interaction with PDCD1/PD-1 inhibits cytotoxic T lymphocytes (CTLs) effector function. The blockage of the PDCD1-mediated pathway results in the reversal of the exhausted T-cell phenotype and the normalization of the anti-tumor response, providing a rationale for cancer immunotherapy"
        ],
        "length": 287,
        "sequence": "MRMFNVFIFTSFCHLLNAFSITVPKDLYVVEYGSNVTIECKFPVEKQLDLGSLVVYWGKEDEEIIQFVNGKEDLKVQHSSYRQRAWLLKDQLYQGNAVLQITNVKLQDAGVYCCMISYGGADYKWITLKVNAPYREISQRISMDPVTSEYELTCQAEGYPEAEVIWTSSDHQILSAKTTITKSQREEKFFNVTSTLRINTTANEIFYCTFKRLSFTENNTAELVIPEPSTLLQRTHFVKLGAVLFCFGAALTILFCLRKNVRMLDVENGGIQDINSRKQNDTQFEET",
        "proteome": null,
        "gene": "PDL1",
        "go_terms": null,
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7b38dac28088143820f932a79d156cf7b2e51fe2",
        "counters": {
            "domain_architectures": 6442,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 2,
                "profile": 1,
                "panther": 1,
                "interpro": 7
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 6442
        }
    }
}