HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F4X8F1",
"id": "F4X8F1_ACREC",
"source_organism": {
"taxId": "103372",
"scientificName": "Acromyrmex echinatior",
"fullName": "Acromyrmex echinatior (Panamanian leafcutter ant)"
},
"name": "Low molecular weight phosphotyrosine protein phosphatase",
"description": [
"Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates"
],
"length": 149,
"sequence": "MICLGNICRSPIAEAVFQNEVKKRGLQDQWKAESAAIIGYHTGKKPDTRARNTLMENGITDYSHTARKIELDDFDKYDWIFGMDQENIKDLLSRKPMTSQAKVELLGSYNPSGIIIIRDPYYDSDSAGFQKAYDQCVTCITAFLNKHSS",
"proteome": "UP000007755",
"gene": "G5I_14631",
"go_terms": [
{
"identifier": "GO:0004725",
"name": "protein tyrosine phosphatase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006470",
"name": "protein dephosphorylation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003993",
"name": "acid phosphatase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004726",
"name": "non-membrane spanning protein tyrosine phosphatase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "43f7edc6f164ca77e7464a273df6f27af22f17a1",
"counters": {
"domain_architectures": 54044,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"smart": 1,
"panther": 1,
"prints": 2,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 54044
}
}
}