General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F4WWG8",
        "id": "F4WWG8_ACREC",
        "source_organism": {
            "taxId": "103372",
            "scientificName": "Acromyrmex echinatior",
            "fullName": "Acromyrmex echinatior (Panamanian leafcutter ant)"
        },
        "name": "U6 snRNA phosphodiesterase",
        "description": [
            "Phosphodiesterase responsible for the U6 snRNA 3' end processing. Acts as an exoribonuclease (RNase) responsible for trimming the poly(U) tract of the last nucleotides in the pre-U6 snRNA molecule, leading to the formation of mature U6 snRNA"
        ],
        "length": 253,
        "sequence": "MAGLHLIQIYSSDSDEDEHDETRKDDHKIVNKLTLPASILSWKGVTCNEEVIDDPLDHDGRIRSFKHERGNWATLIYINYIPSDCLHTWMKSVLNKLPVEGNIISSLHISLSRTLVLKLHWIESFVEDIKLACRSFNKFIIQLTDVRVYCNEERTRTFLGIYCQDEDKMLKCLTEIFDNLLAEYQLPSFYKDTSYHISFFWCLGDKQACLKEILPPLTSSLNKFLAENMEDAYVHVNDIQCKIGNKCYTFKLK",
        "proteome": "UP000007755",
        "gene": "G5I_10285",
        "go_terms": [
            {
                "identifier": "GO:0004518",
                "name": "nuclease activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0034477",
                "name": "U6 snRNA 3'-end processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "42be7a1cae5e1a230af555b7c67481ff2be7af6e",
        "counters": {
            "domain_architectures": 4056,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "hamap": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4056
        }
    }
}