HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F4WUY8",
"id": "F4WUY8_ACREC",
"source_organism": {
"taxId": "103372",
"scientificName": "Acromyrmex echinatior",
"fullName": "Acromyrmex echinatior (Panamanian leafcutter ant)"
},
"name": "Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial",
"description": [
"Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q)"
],
"length": 279,
"sequence": "MVGVIPYTCRSALRQIRALHTATVQNAEAKLKTFSIYRWNPDKPDEKPYMQKYKVDLNACGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIGGTNTLACISKIDKSTSTSCEVYPLPHMYIVKDLVPDLNNFYDQYRNIQPWLQHKDTKETGNEQYLQSVEDRKKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWIIDSRDTQAKERLEKLKDPFSVYRCHTIMNCTRTCPKGLNPGKAIAEIKKLLANLSQKPQSDLTASGSS",
"proteome": "UP000007755",
"gene": "G5I_09690",
"go_terms": [
{
"identifier": "GO:0051536",
"name": "iron-sulfur cluster binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009055",
"name": "electron transfer activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006099",
"name": "tricarboxylic acid cycle",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0051537",
"name": "2 iron, 2 sulfur cluster binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e3c13263eee326ff8609d36a527989825e0a205f",
"counters": {
"domain_architectures": 12687,
"entries": 23,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"profile": 2,
"pfam": 2,
"panther": 1,
"ncbifam": 2,
"prosite": 2,
"interpro": 10
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 12687
}
}
}