GET /api/protein/UniProt/F4FXZ8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F4FXZ8",
        "id": "F4FXZ8_METCR",
        "source_organism": {
            "taxId": "1006006",
            "scientificName": "Metallosphaera cuprina (strain Ar-4)",
            "fullName": "Metallosphaera cuprina (strain Ar-4)"
        },
        "name": "Thiamine thiazole synthase",
        "description": [
            "Involved in the biosynthesis of the thiazole moiety of thiamine. Catalyzes the conversion of NAD and glycine to adenosine diphosphate 5-(2-hydroxyethyl)-4-methylthiazole-2-carboxylate (ADT), an adenylated thiazole intermediate, using free sulfide as a source of sulfur"
        ],
        "length": 265,
        "sequence": "MNVKQVDETKITRYILRATFEDWMDFSVNDVVIVGAGPSGLSAAYYLAKSGLKTTVFERRLSFGGGIGGGAMLFHKIIIESPADEILRGIGVRLHKFEEGVYAVDSAELMAKLATAAIDAGAKIIHGVTVDDVIFRENPLRVTGVAVEWTATQMAALHVDPLFISARAVVDATGHDAEVISVASRKLPELGIAIPGEKSAYSEIAEQLTVEQTGEVAPGLYATGMAVTEIKALPRMGPIFGAMILSGKRVAEDIIAKLNVKIHNT",
        "proteome": "UP000007812",
        "gene": "thi4",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "571e71cd852e674548876e8def22d01138018e85",
        "counters": {
            "domain_architectures": 3749,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "pfam": 1,
                "prints": 2,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3749
        }
    }
}