GET /api/protein/UniProt/F4FXZ8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F4FXZ8",
"id": "F4FXZ8_METCR",
"source_organism": {
"taxId": "1006006",
"scientificName": "Metallosphaera cuprina (strain Ar-4)",
"fullName": "Metallosphaera cuprina (strain Ar-4)"
},
"name": "Thiamine thiazole synthase",
"description": [
"Involved in the biosynthesis of the thiazole moiety of thiamine. Catalyzes the conversion of NAD and glycine to adenosine diphosphate 5-(2-hydroxyethyl)-4-methylthiazole-2-carboxylate (ADT), an adenylated thiazole intermediate, using free sulfide as a source of sulfur"
],
"length": 265,
"sequence": "MNVKQVDETKITRYILRATFEDWMDFSVNDVVIVGAGPSGLSAAYYLAKSGLKTTVFERRLSFGGGIGGGAMLFHKIIIESPADEILRGIGVRLHKFEEGVYAVDSAELMAKLATAAIDAGAKIIHGVTVDDVIFRENPLRVTGVAVEWTATQMAALHVDPLFISARAVVDATGHDAEVISVASRKLPELGIAIPGEKSAYSEIAEQLTVEQTGEVAPGLYATGMAVTEIKALPRMGPIFGAMILSGKRVAEDIIAKLNVKIHNT",
"proteome": "UP000007812",
"gene": "thi4",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "571e71cd852e674548876e8def22d01138018e85",
"counters": {
"domain_architectures": 3749,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 1,
"pfam": 1,
"prints": 2,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3749
}
}
}