GET /api/protein/UniProt/F2T480/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F2T480",
"id": "F2T480_AJEDA",
"source_organism": {
"taxId": "653446",
"scientificName": "Ajellomyces dermatitidis (strain ATCC 18188 / CBS 674.68)",
"fullName": "Ajellomyces dermatitidis (strain ATCC 18188 / CBS 674.68)"
},
"name": "Coatomer subunit zeta",
"description": [
"The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. The zeta subunit may be involved in regulating the coat assembly and, hence, the rate of biosynthetic protein transport due to its association-dissociation properties with the coatomer complex"
],
"length": 202,
"sequence": "MPVPISLFSVNAILIMSTDDSSRIFAKYYSPPHPPAGTAANSLDYPGANPYPTVKDQKAFESGLLEKTVKQTSDIILYDNRVVVFKTEGDVMLYVVGGAEENEVLLYNVVLALRDSLNILLRSGVDKRSIIENYDLVSLAVDEIVDDGIFLETDAVHIASRVSRAPAQDAPNMKGIDLSEQGLLNAWEFGKRRLAEQLRHGL",
"proteome": null,
"gene": "BDDG_00676",
"go_terms": [
{
"identifier": "GO:0006890",
"name": "retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0030126",
"name": "COPI vesicle coat",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "06d32c800fac36020d03f379936b1bd62ff88561",
"counters": {
"domain_architectures": 27458,
"entries": 8,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 27458
}
}
}