GET /api/protein/UniProt/F2KML1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F2KML1",
"id": "F2KML1_ARCVS",
"source_organism": {
"taxId": "693661",
"scientificName": "Archaeoglobus veneficus (strain DSM 11195 / SNP6)",
"fullName": "Archaeoglobus veneficus (strain DSM 11195 / SNP6)"
},
"name": "Polyamine aminopropyltransferase",
"description": [
"Catalyzes the irreversible transfer of a propylamine group from the amino donor S-adenosylmethioninamine (decarboxy-AdoMet) to putrescine (1,4-diaminobutane) to yield spermidine"
],
"length": 276,
"sequence": "MEWFIEASDNYGLMIRVRKKLYEFKGLQHIEIYDTVFGKMLVIDGYVQFIERFEASYHEMLAHVPMLTHPSPKKVLIIGGGDGGTAREVLKHDPDEVVMVEIDRNVVEACRQHVGIDKGALDDPRLTLLIENGIEYVKNCDEKFDVLIVDGTDPSPASEPLFSPDFYRACSRISDIYAMQSQSPVLQEKEFRTVLRNTAVFRERRVYLSYIPMYPGGIWSFLIASDSSLNVELDKIRRRFEERRIETEYYTPEVHVAAFTLPRWLENIVREMGLEV",
"proteome": "UP000008136",
"gene": "speE",
"go_terms": [
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "090b752ef5f88e1716cd205da090ef795e2a8e15",
"counters": {
"domain_architectures": 14482,
"entries": 18,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"profile": 1,
"pfam": 2,
"ssf": 1,
"cdd": 1,
"ncbifam": 2,
"hamap": 1,
"panther": 1,
"prosite": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 14482
}
}
}