HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F2KE57",
"id": "F2KE57_PSEBN",
"source_organism": {
"taxId": "994484",
"scientificName": "Pseudomonas brassicacearum (strain NFM421)",
"fullName": "Pseudomonas brassicacearum (strain NFM421)"
},
"name": "RNA polymerase sigma factor FliA",
"description": [
"Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor controls the expression of flagella-related genes"
],
"length": 247,
"sequence": "MTASGYNHLYKKSARDAQYELIERYAPLVKRIAYHLLARLPASVQVEDLIQAGMIGLLEVSNKYDASKGASFETYAGIRIRGAMLDEVRKGDWAPRSVHRNTRMVSDAIRAIEAKTGRDAKDHEVAAELQLSLDDYYGILNDTLGSRLFSFDDLLQDGEHEGLHEDNASAHMEPSRDLEDERFQSALAEAIANLPERERLVLALYYDEELNLKEIGEVLGVSESRVSQLHSQCAARLRGRLGEWRAR",
"proteome": null,
"gene": "fliA",
"go_terms": [
{
"identifier": "GO:0003700",
"name": "DNA-binding transcription factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006352",
"name": "DNA-templated transcription initiation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003899",
"name": "DNA-directed RNA polymerase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016987",
"name": "sigma factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "0101b1137e4df9f854c5ee3d2919fb45e7bcc49d",
"counters": {
"domain_architectures": 31499,
"entries": 24,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"pfam": 3,
"cdd": 1,
"hamap": 1,
"ncbifam": 3,
"panther": 1,
"pirsf": 1,
"prints": 1,
"interpro": 9
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 31499
}
}
}