General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F1RR17",
        "id": "F1RR17_PIG",
        "source_organism": {
            "taxId": "9823",
            "scientificName": "Sus scrofa",
            "fullName": "Sus scrofa (Pig)"
        },
        "name": "Protein N-terminal glutamine amidohydrolase",
        "description": [
            "Mediates the side-chain deamidation of N-terminal glutamine residues to glutamate, an important step in N-end rule pathway of protein degradation. Conversion of the resulting N-terminal glutamine to glutamate renders the protein susceptible to arginylation, polyubiquitination and degradation as specified by the N-end rule. Does not act on substrates with internal or C-terminal glutamine and does not act on non-glutamine residues in any position. Does not deaminate acetylated N-terminal glutamine. With the exception of proline, all tested second-position residues on substrate peptides do not greatly influence the activity. In contrast, a proline at position 2, virtually abolishes deamidation of N-terminal glutamine"
        ],
        "length": 207,
        "sequence": "MEGDVPVAAAAHYQPASPPRDACVYNSCYCEENIWKLCEYIKNHDQYPLEECYAVFISNERKMIPIWKQQARPGDGPVIWDYHVVLLHVSSGGQSFIYDLDTVLPFPCPFDTYVEDAFKSDEDIHPQFRRKFRVIRADSYLKNFASDRSHMKDSSGNWREPPPSYPCIETGDSKMNLNDFISMDPEVGWGAVYSLSEFVHRFGSQNY",
        "proteome": "UP000008227",
        "gene": "NTAQ1",
        "go_terms": [
            {
                "identifier": "GO:0016811",
                "name": "hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008418",
                "name": "protein-N-terminal asparagine amidohydrolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0070773",
                "name": "protein-N-terminal glutamine amidohydrolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "32326761a8db4a7e126cdc3080a097527e7a7d2e",
        "counters": {
            "domain_architectures": 2655,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2655
        }
    }
}