General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F1CGT6",
        "id": "SCX9_CENSU",
        "source_organism": {
            "taxId": "6880",
            "scientificName": "Centruroides suffusus",
            "fullName": "Centruroides suffusus (Durango bark scorpion)"
        },
        "name": "Beta-neurotoxin Css9",
        "description": [
            "Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin compete with high affinity with 125I-Css4 bound on rat brain synaptosome and may bind with high affinity to Nav1.1/SCN1A, Nav1.2/SCN2A and Nav1.6/SCN8A"
        ],
        "length": 82,
        "sequence": "MKLLMLIVALMIIGVQSKDGYPMDHKGCKISCVINNKYCETECVTVLKGKKGYCYFWKLACYCEGLPNWAKVWDRATNKCRA",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0006952",
                "name": "defense response",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008200",
                "name": "ion channel inhibitor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019871",
                "name": "sodium channel inhibitor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0090729",
                "name": "toxin activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "91cf9b65efdbf553bdb99b3376bcd79a3f1ef44f",
        "counters": {
            "domain_architectures": 1101,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "ssf": 1,
                "pfam": 1,
                "profile": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 1101
        }
    }
}