General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F0X710",
        "id": "F0X710_GROCL",
        "source_organism": {
            "taxId": "655863",
            "scientificName": "Grosmannia clavigera (strain kw1407 / UAMH 11150)",
            "fullName": "Grosmannia clavigera (strain kw1407 / UAMH 11150) (Blue stain fungus)"
        },
        "name": "Histidine--tRNA ligase, mitochondrial",
        "description": [
            "Catalyzes the aminoacylation of histidyl-tRNA in both the cytoplasm and the mitochondrion"
        ],
        "length": 496,
        "sequence": "MRMATKEKQEKQEKAKAAAVQLKVPKGTRDWTGADSIIRDSIFQTVTDVFRRHGAVALDTPVFELKEVLAGKYGEDSRLIYDLADQGGELCALRYDLTVPFARWLAMNKVQQFRRYHIAKVYRRDQPAVARGRMREFYQCDFDIAGQYDRMIPDAEILRVVHEVFAALQQDIVVKLNHRQILDGIFAVSGVPDDKIRTISSAVDKLDKLPWAEVRKEMVEEKGLAEVVADQIGDYVKHSGDIATVVALLRADARLAADPNIQQGVADMELLATYLDAFGVPSSQISFDLSLCRGLDYYTGLIFEVIVRPTAEEAEEASAQDRKKSKSKSKAAEEPQVGSIAAGGRYDNLVGMYGKTQIPCVGISFGVDRIFTILKARREKEAGRQRVRETDVYVMAFGAGAGFTGLLTERMRIARRLWDAGIKAEFVAKTKPRLPQQFKAAEDVPLGVILGEDELAQGQVRLKMLGTGAAGEADEKDRGQLVAEEDLAAEIKKLLI",
        "proteome": "UP000007796",
        "gene": "CMQ_6972",
        "go_terms": [
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0004821",
                "name": "histidine-tRNA ligase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006427",
                "name": "histidyl-tRNA aminoacylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "117fb1096684c273e42b67dd5e2a0bafce0d76dc",
        "counters": {
            "domain_architectures": 29817,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "cathgene3d": 2,
                "ssf": 2,
                "pfam": 2,
                "cdd": 1,
                "panther": 1,
                "pirsf": 1,
                "ncbifam": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 29817
        }
    }
}