General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F0TA28",
        "id": "F0TA28_METLA",
        "source_organism": {
            "taxId": "877455",
            "scientificName": "Methanobacterium lacus (strain AL-21)",
            "fullName": "Methanobacterium lacus (strain AL-21)"
        },
        "name": "GTP-dependent dephospho-CoA kinase",
        "description": [
            "Catalyzes the GTP-dependent phosphorylation of the 3'-hydroxyl group of dephosphocoenzyme A to form coenzyme A (CoA)"
        ],
        "length": 169,
        "sequence": "MLILKQDMRSEFKKPIGTLFPTISDAKDSLDKKGEKGLLISIGDVTTRKMLDEGIIPDVGIVDNLIEREPSDYEICYDNVTLKTKNPPGTITDQMWKTIKEGFSLVEKAGYNVLIVVDGEEDLSAIPCMVMAPEGSIIFYGQPGEGVVLCEVDKTKEKAQDLIKKLEEA",
        "proteome": "UP000007490",
        "gene": "Metbo_0600",
        "go_terms": [
            {
                "identifier": "GO:0016301",
                "name": "kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015937",
                "name": "coenzyme A biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c266ffd6ecf36b235c4486789911a6bdd588f6e3",
        "counters": {
            "domain_architectures": 938,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pirsf": 1,
                "panther": 1,
                "hamap": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 938
        }
    }
}