General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F0NIB2",
        "id": "F0NIB2_SACI5",
        "source_organism": {
            "taxId": "930945",
            "scientificName": "Saccharolobus islandicus (strain REY15A)",
            "fullName": "Saccharolobus islandicus (strain REY15A)"
        },
        "name": "Histidinol dehydrogenase",
        "description": [
            "Catalyzes the sequential NAD-dependent oxidations of L-histidinol to L-histidinaldehyde and then to L-histidine"
        ],
        "length": 398,
        "sequence": "MISYSLPNERPNDFSRVIPVVRDIIESVKARGDNALYQLTEKLDKVKINNIKVSEEELKTQASKLDPKVKQAIDVAYEQLKAFHEMLVPPNIGGGYQGISFGVVWRSIEKIGIYVPSGKYSYPSTLLMAGIPAKVAKVKEIYVASPPNQEGSVNPALAYVAIKLGVNDVYKVGGAQAIAALAYGTESVRKVYKIVGPGNVYVQAAKFLVSNVVGIDGIEGPTELVIIADETAKPEHVVLDMKAQAEHGPDTYIVLLSNDDELLKKVEEKIMDDKKIYYIIKTKNIDEAIEIANKIAPEHLSLYVKDAYTLMDKIVNAGAISLGNTPPAIIDYVAGPNHILPTNGWARIRGGVTVYDFIKPTMYANVRDINKQLLEASISLANYEGFVIHGKSIGVRYE",
        "proteome": "UP000002664",
        "gene": "hisD",
        "go_terms": [
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016616",
                "name": "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051287",
                "name": "NAD binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004399",
                "name": "histidinol dehydrogenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000105",
                "name": "L-histidine biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "74c29885d030723b3b179c70eea1bde480f9dc66",
        "counters": {
            "domain_architectures": 29362,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cdd": 1,
                "cathgene3d": 2,
                "hamap": 1,
                "pirsf": 1,
                "panther": 1,
                "pfam": 1,
                "ncbifam": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 29362
        }
    }
}