GET /api/protein/UniProt/F0EN24/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F0EN24",
        "id": "F0EN24_ENTCA",
        "source_organism": {
            "taxId": "888066",
            "scientificName": "Enterococcus casseliflavus ATCC 12755",
            "fullName": "Enterococcus casseliflavus ATCC 12755"
        },
        "name": "Anhydro-N-acetylmuramic acid kinase",
        "description": [
            "Catalyzes the specific phosphorylation of 1,6-anhydro-N-acetylmuramic acid (anhMurNAc) with the simultaneous cleavage of the 1,6-anhydro ring, generating MurNAc-6-P. Is required for the utilization of anhMurNAc either imported from the medium or derived from its own cell wall murein, and thus plays a role in cell wall recycling"
        ],
        "length": 407,
        "sequence": "MSVKSNSTIAFITILKERRNDMLAIGLMSGTSLDGIDAALVKINGCGTETDVQLMEMLTLPIGEELKERIKTACDPVESNVPLICQLNTELGYQFLEACQILCQKAGIEEKSIDFVASHGQTIWHSPDADPAKNSTLQIGEPSIIAYGLQTKVVADFRVMDMAAGGQGAPLVPYTDYLLYQSDDKNRLLQNIGGIGNVTVLPKDGGLSELYAFDTGPGNMVIDELMVQLFGQPYDAFGETARAGAIIPTLQKELRTHFYLSQQPPKSTGREQFGKHFVQQLMTEYPQVASEDLVRTLTDFTAFSIADSYQRFIFPQLRTNDIEVILSGGGAHNHLLIEMIKGYLPETVAVVTQDDIGGSNDAKEAVAFAILGNETLHSRVNNAPAATGAAQGVILGKIIPNPWETKM",
        "proteome": null,
        "gene": "anmK",
        "go_terms": [
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016773",
                "name": "phosphotransferase activity, alcohol group as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006040",
                "name": "amino sugar metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009254",
                "name": "peptidoglycan turnover",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "81e70995a84cea65c6e8d43617b1eb305ab52eb6",
        "counters": {
            "domain_architectures": 15427,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cdd": 1,
                "cathgene3d": 1,
                "ncbifam": 2,
                "panther": 1,
                "hamap": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 15427
        }
    }
}