HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F0EN24",
"id": "F0EN24_ENTCA",
"source_organism": {
"taxId": "888066",
"scientificName": "Enterococcus casseliflavus ATCC 12755",
"fullName": "Enterococcus casseliflavus ATCC 12755"
},
"name": "Anhydro-N-acetylmuramic acid kinase",
"description": [
"Catalyzes the specific phosphorylation of 1,6-anhydro-N-acetylmuramic acid (anhMurNAc) with the simultaneous cleavage of the 1,6-anhydro ring, generating MurNAc-6-P. Is required for the utilization of anhMurNAc either imported from the medium or derived from its own cell wall murein, and thus plays a role in cell wall recycling"
],
"length": 407,
"sequence": "MSVKSNSTIAFITILKERRNDMLAIGLMSGTSLDGIDAALVKINGCGTETDVQLMEMLTLPIGEELKERIKTACDPVESNVPLICQLNTELGYQFLEACQILCQKAGIEEKSIDFVASHGQTIWHSPDADPAKNSTLQIGEPSIIAYGLQTKVVADFRVMDMAAGGQGAPLVPYTDYLLYQSDDKNRLLQNIGGIGNVTVLPKDGGLSELYAFDTGPGNMVIDELMVQLFGQPYDAFGETARAGAIIPTLQKELRTHFYLSQQPPKSTGREQFGKHFVQQLMTEYPQVASEDLVRTLTDFTAFSIADSYQRFIFPQLRTNDIEVILSGGGAHNHLLIEMIKGYLPETVAVVTQDDIGGSNDAKEAVAFAILGNETLHSRVNNAPAATGAAQGVILGKIIPNPWETKM",
"proteome": null,
"gene": "anmK",
"go_terms": [
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016773",
"name": "phosphotransferase activity, alcohol group as acceptor",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006040",
"name": "amino sugar metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0009254",
"name": "peptidoglycan turnover",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "81e70995a84cea65c6e8d43617b1eb305ab52eb6",
"counters": {
"domain_architectures": 15427,
"entries": 10,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cdd": 1,
"cathgene3d": 1,
"ncbifam": 2,
"panther": 1,
"hamap": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 15427
}
}
}