General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E9GRS6",
        "id": "E9GRS6_DAPPU",
        "source_organism": {
            "taxId": "6669",
            "scientificName": "Daphnia pulex",
            "fullName": "Daphnia pulex (Water flea)"
        },
        "name": "Sugar phosphate phosphatase",
        "description": [
            "Metal-dependent phosphatase that shows phosphatase activity against several substrates, including fructose-1-phosphate and fructose-6-phosphate. Its preference for fructose-1-phosphate, a strong glycating agent that causes DNA damage rather than a canonical yeast metabolite, suggests a damage-control function in hexose phosphate metabolism. Has also been shown to have O-methyltransferase activity that methylates glutamate residues of target proteins to form gamma-glutamyl methyl ester residues. Possibly methylates PCNA, suggesting it is involved in the DNA damage response"
        ],
        "length": 444,
        "sequence": "MTFSFNKSRPPYPYLSAEIEGSFAYRTVKDRMPVILTKVIDFLCRSKNEIVQSSHSEAAALEDLKLIIGKLSKLRSEMQTNKTLSKFEIDCPHLQDSEKWNTELIETKDSAAPCWFNSPWLLVECYMYRAIYYMFNDSLYLKGFDPFSHMKEEAFFVQKNIICQLASYTNGLCLKSNYSSSELHVHFMKLIEICLWGNRNDLSLSAGNTNTEVKSNSFFDDIKQLNSHILVNNINEVWLHMEHIQNNPYDNKELSIIMDNSGLEMVADLCLAVYCISHKLFDRVNFYVKKIPWFVSDTTCNDLKWALQYMENDCTELQHFAEKCRAYLHSNQFQVLEESYFTLPLPYHVMQEEDPKLYKKLCRSQLIIFKGDLNYRKLGGELCWPSSTPFKTFLQGFSPAPLLALRTIKAEIICDLPSSKIKELDLLDKDWMTNGNYGLIQFAK",
        "proteome": "UP000000305",
        "gene": "DAPPUDRAFT_305328",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e2a89aa3ba3095094a72bfc32ef0790cb67afb49",
        "counters": {
            "domain_architectures": 8378,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 8378
        }
    }
}