GET /api/protein/UniProt/E9G2L1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E9G2L1",
        "id": "E9G2L1_DAPPU",
        "source_organism": {
            "taxId": "6669",
            "scientificName": "Daphnia pulex",
            "fullName": "Daphnia pulex (Water flea)"
        },
        "name": "NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12",
        "description": [
            "Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone"
        ],
        "length": 143,
        "sequence": "MAKYITAFLDKAKISVDILKQNGGIRGSFYTFFRTDDLKNGTVVGKDKYGNTYYENNRYFVGRNRWVIYNDNVYLEYDGSQVPAEWYGWLHYKTDLPPTVKPPVHYKWMIDHIENKSGTEEAYMPCSTTKSKIQAWDPNAKKE",
        "proteome": "UP000000305",
        "gene": "DAPPUDRAFT_230517",
        "go_terms": [
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0045271",
                "name": "respiratory chain complex I",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d25303ede2d23cc5606a3fd67c28712795a4d380",
        "counters": {
            "domain_architectures": 10177,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 10177
        }
    }
}