HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "E9F9S9",
"id": "E9F9S9_METRA",
"source_organism": {
"taxId": "655844",
"scientificName": "Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)",
"fullName": "Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)"
},
"name": "Endoglucanase EG-II",
"description": [
"Endoglucanase (EG) that cleaves the internal beta-1,4-glucosidic bonds in cellulose. The degradation of cellulose involves an interplay between different cellulolytic enzymes. Hydrolysis starts with EGs, which cut internal glycosidic linkages to reduce the polymerization degree of the substrate and creates new chain ends for exocellobiohydrolases (CBHs). The CBH release the disaccharide cellobiose from the non-reducing end of the cellulose polymer chain. Finally, beta-1,4-glucosidases hydrolyze the cellobiose and other short cello-oligosaccharides into glucose units"
],
"length": 394,
"sequence": "MAGIDFGCDIDGSCPGDHVQVPLASLGGADSAGQMKHFVDDDGMNTFRLSMSWQYITAGQPSGGLDKINFGNFDKLVQACLDTGAYCMLDLHNFARYDGGIIGQGGPSDDVFAGLWKQLATYYAKSDKIIFGLMNEPHDLDIKMWAKSCQAAVTAIRKAGATSQLILLPGTNFASAETFVSTGSAEALAAITNPDGSTDNLLLDLHKYLDINNSGTHAECTTNNVAGFKTIAEWLRKNKRLALVSESGASMDQSCMTKFCEQNDFIAENDDVLVGFVGWGAGGFDDTYVLTLTPSRSGDAWTDNKLMKQCIIAPFGKAASATASTTQAPTSTTTTSMSATSTEQAADKTPSATPGTKNTNANEAAPKKGNAADHVAISHIYIILASMAGLRLYL",
"proteome": "UP000002498",
"gene": "MAA_09028",
"go_terms": [
{
"identifier": "GO:0004553",
"name": "hydrolase activity, hydrolyzing O-glycosyl compounds",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000272",
"name": "polysaccharide catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005975",
"name": "carbohydrate metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "875391754e3957f1d7d7d3fdccae1349b8da9a18",
"counters": {
"domain_architectures": 33798,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 1,
"ssf": 1,
"panther": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 33798
}
}
}