General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E9AE39",
        "id": "E9AE39_LEIMA",
        "source_organism": {
            "taxId": "5664",
            "scientificName": "Leishmania major",
            "fullName": "Leishmania major"
        },
        "name": "2-(3-amino-3-carboxypropyl)histidine synthase subunit 1",
        "description": [
            "Catalyzes the first step of diphthamide biosynthesis, a post-translational modification of histidine which occurs in elongation factor 2"
        ],
        "length": 373,
        "sequence": "MQALDDVQHDQKQQRETQRKLGLPTNYRFEIDKCIKRIKEKDARRVALQFPEGLLMFAVPIADILEEATGSEMVILGDVTYGACCVDDFSAAALGCDFLIHYGHSCLISIKDCIVANMMYVFVEIDIDVQHFVDTIKALVPADARVACIGTVQFISSMRAGLRVLQAEHFIHPVVIPQNRPLSTGEVLGCTSPKVNPAEVDLVLYVGDGRFHVESFLIAHPGLSALQYDPYKKTLSRETYATAEMRTLRRGAVEKAKAAQSFAIVMGTLGRQGHPRVVDRIIALAQRQGKRVTLLLMSEIFPQKMAMLEDVDCYIQVACPRLSIDWGYAFDRPLLSPYEAEVALGNAQWGEEYPMDHYSREGGNWAVYTDKSL",
        "proteome": "UP000000542",
        "gene": "LMJF_29_1780",
        "go_terms": [
            {
                "identifier": "GO:0090560",
                "name": "2-(3-amino-3-carboxypropyl)histidine synthase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0017183",
                "name": "protein histidyl modification to diphthamide",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3a7bb4719785c490f9695451c41f9eb2b83c367f",
        "counters": {
            "domain_architectures": 10011,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ncbifam": 1,
                "cathgene3d": 3,
                "pirsf": 1,
                "panther": 1,
                "sfld": 2,
                "pfam": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 10011
        }
    }
}