GET /api/protein/UniProt/E8XF95/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "E8XF95",
"id": "E8XF95_SALT4",
"source_organism": {
"taxId": "909946",
"scientificName": "Salmonella typhimurium (strain 4/74)",
"fullName": "Salmonella typhimurium (strain 4/74)"
},
"name": "4'-phosphopantetheinyl transferase AcpT",
"description": [
"May be involved in an alternative pathway for phosphopantetheinyl transfer and holo-ACP synthesis. The native apo-protein substrate is unknown"
],
"length": 192,
"sequence": "MYQVVLGKVSTLSAGQLPDALIAQAPQGVRRASWLAGRVLLSRALSPLPEMVYGEQGKPAFSAGAPLWFNLSHSGDTIALLLSDEGEVGCDIEVIRPRDNWRSLANAVFSLGEHAEMEAERPEQQLAAFWRIWTRKEAIVKQRGGSAWQIVSVDSTLPSALSVSQCQLDTLSLAVCTPTPFTLTPQTITKAL",
"proteome": null,
"gene": "acpT",
"go_terms": [
{
"identifier": "GO:0000287",
"name": "magnesium ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008897",
"name": "holo-[acyl-carrier-protein] synthase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e95bd032824ec42d20f1a59244ad0c4ab2df36cb",
"counters": {
"domain_architectures": 32397,
"entries": 8,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"ncbifam": 1,
"panther": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 32397
}
}
}