GET /api/protein/UniProt/E8TJM7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E8TJM7",
        "id": "E8TJM7_MESCW",
        "source_organism": {
            "taxId": "765698",
            "scientificName": "Mesorhizobium ciceri biovar biserrulae (strain HAMBI 2942 / LMG 23838 / WSM1271)",
            "fullName": "Mesorhizobium ciceri biovar biserrulae (strain HAMBI 2942 / LMG 23838 / WSM1271)"
        },
        "name": "Nodulation protein J",
        "description": [
            "Part of the ABC transporter complex NodIJ involved in the export of the nodulation factors (Nod factors), the bacterial signal molecules that induce symbiosis and subsequent nodulation induction. Nod factors are LCO (lipo-chitin oligosaccharide), a modified beta-1,4-linked N-acetylglucosamine oligosaccharide. This subunit encodes the transporter"
        ],
        "length": 262,
        "sequence": "MREGLAAALPANAWNWIAVWRRNYLAWKKVAFVSLLGTLADPMIYLFGLGTGLGLMIGRVEGASYIAFLAAGMVATGAMTASTFETIYAVFSRMRDLGTWEAILHTQLTLGDIVLGELAWAATKAFLAGTAITIVAVMLGYADWTSLPYVLPVVALTGFAFASLAMVVIALTPSYHYFIFYQTLVITPMLFLSGAVFPVGQLPGAFQRVAAFSPLANSIDLIRPAMLGHVADNVGLHIGALCMYTVLPFFLSAALFRRRLMR",
        "proteome": null,
        "gene": "Mesci_5866",
        "go_terms": [
            {
                "identifier": "GO:0140359",
                "name": "ABC-type transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0022857",
                "name": "transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015772",
                "name": "oligosaccharide transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0055085",
                "name": "transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0043190",
                "name": "ATP-binding cassette (ABC) transporter complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8f38eedd1c56d1feb9352ec1d060393d0e636d24",
        "counters": {
            "domain_architectures": 95534,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "profile": 1,
                "ncbifam": 1,
                "panther": 1,
                "pirsf": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 95534
        }
    }
}