GET /api/protein/UniProt/E8T6K9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "E8T6K9",
        "id": "E8T6K9_THEA1",
        "source_organism": {
            "taxId": "648996",
            "scientificName": "Thermovibrio ammonificans (strain DSM 15698 / JCM 12110 / HB-1)",
            "fullName": "Thermovibrio ammonificans (strain DSM 15698 / JCM 12110 / HB-1)"
        },
        "name": "Formyltetrahydrofolate deformylase",
        "description": [
            "Catalyzes the hydrolysis of 10-formyltetrahydrofolate (formyl-FH4) to formate and tetrahydrofolate (FH4)"
        ],
        "length": 284,
        "sequence": "MAETATLLISCPDRKGILAEVTGFIARNGGNILHADQHIDFQKSIFFMRIEWDLSGFKIPKGEIEKAFRPIAQQFKMNYQLHFSSEVKRVAIFVSKYDHCLYELLYRFKAGELKGELVTVISNHRDLQPVVEMFGVPFVYSPKSRENKREAEEREIEILEREGIDLIVLARYMQILSDRFVNRFRNRIINIHHSFLPAFVGAKPYHRAYERGVKIIGATSHYVTEELDQGPIIEQDVVRVTHRDSVEDMIRKGRDLEKLVLARAVKWHLENKVLVYDNKTVIFE",
        "proteome": "UP000006362",
        "gene": "purU",
        "go_terms": [
            {
                "identifier": "GO:0009058",
                "name": "biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008864",
                "name": "formyltetrahydrofolate deformylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006189",
                "name": "'de novo' IMP biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a4d8960a650ba3ddb666c432b141596c6efb45f0",
        "counters": {
            "domain_architectures": 11048,
            "entries": 22,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "pfam": 2,
                "cdd": 2,
                "profile": 1,
                "hamap": 1,
                "pirsf": 1,
                "ncbifam": 2,
                "panther": 1,
                "prints": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 11048
        }
    }
}